SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000428741 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428741
Domain Number 1 Region: 131-207
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.61e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0000299
Further Details:      
 
Domain Number 2 Region: 33-112
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 8.01e-19
Family Double-stranded RNA-binding domain (dsRBD) 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428741   Gene: ENSG00000040341   Transcript: ENST00000523558
Sequence length 398
Comment pep:putative chromosome:GRCh37:8:74333365:74659075:-1 gene:ENSG00000040341 transcript:ENST00000523558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALQALQNEPIPERSPQNGESGKDVDDDKDANKSEISLVFEIALKRNMPVSFEVIKESG
PPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPVVEKPKLFFKKRP
KTIVKAGPEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVAT
GTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGI
LHLSPDVYQEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNG
TSSTAEAIGLKGSSPTPPCSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMN
IEKGSLEKQAKHLREKADNNQAPPGSIAQDCKKSNSAV
Download sequence
Identical sequences A0A0A0MTC4
ENSP00000428741 NP_001157855.1.87134 NP_001157855.1.92137 gi|256419001|ref|NP_001157855.1| ENSP00000428741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]