SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429278 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429278
Domain Number 1 Region: 107-393
Classification Level Classification E-value
Superfamily RNI-like 3.03e-57
Family 28-residue LRR 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429278   Gene: ENSG00000171757   Transcript: ENST00000522526
Sequence length 432
Comment pep:known chromosome:GRCh37:3:169511261:169530774:-1 gene:ENSG00000171757 transcript:ENST00000522526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQPPRPVGERSMGSSREAARAPARSPAWASTQASTPGAALAVQRESPESGLQKHYSNL
CMEKSQKINPFILHILQEVDEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILK
NCLYINGLDVGYNLLCDVGAYYAAKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHKNRT
LKYLRMTGNKIENKGGMFFAAMLQINSSLEKLDLGDCDLEESTVHVGRMLKENHCLVALH
MCKHDIKNSGIQQLCDALYLNSSLRYLDVSCNKITHDGMVYLADVLKSNTTLEVIDLSFN
RIENAGANYLSETLTSHNRSLKALSVVSNNIEGEGLVALSQSMKTNLTFSHIYIWGNKFD
EATCIAYSDLIQMGCLKPDNTDVEPFVVDGRVYLAEVSNGLKKHYYWTSTYGESYDHSSN
AGFALVPVGQQP
Download sequence
Identical sequences ENSP00000429278 gi|289666778|ref|NP_699184.2| NP_699184.2.87134 NP_699184.2.92137 ENSP00000429278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]