SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429944 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429944
Domain Number 1 Region: 34-75
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000222
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429944   Gene: ENSG00000063438   Transcript: ENST00000504625
Sequence length 81
Comment pep:putative chromosome:GRCh37:5:343643:354026:1 gene:ENSG00000063438 transcript:ENST00000504625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQ
Download sequence
Identical sequences E5RGQ2
ENSP00000429944 ENSP00000429944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]