SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430620 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430620
Domain Number 1 Region: 77-266
Classification Level Classification E-value
Superfamily Cupredoxins 1.83e-55
Family Multidomain cupredoxins 0.00000553
Further Details:      
 
Domain Number 2 Region: 276-420
Classification Level Classification E-value
Superfamily Cupredoxins 4.24e-50
Family Multidomain cupredoxins 0.00000411
Further Details:      
 
Domain Number 3 Region: 785-964
Classification Level Classification E-value
Superfamily Cupredoxins 2.38e-48
Family Multidomain cupredoxins 0.00000349
Further Details:      
 
Domain Number 4 Region: 431-625
Classification Level Classification E-value
Superfamily Cupredoxins 2.14e-47
Family Multidomain cupredoxins 0.00000588
Further Details:      
 
Domain Number 5 Region: 972-1118
Classification Level Classification E-value
Superfamily Cupredoxins 4.7e-46
Family Multidomain cupredoxins 0.000004
Further Details:      
 
Domain Number 6 Region: 628-772
Classification Level Classification E-value
Superfamily Cupredoxins 1.02e-42
Family Multidomain cupredoxins 0.0000839
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430620   Gene: ENSG00000089472   Transcript: ENST00000519389
Sequence length 1212
Comment pep:known chromosome:GRCh37:X:65382391:65488709:1 gene:ENSG00000089472 transcript:ENST00000519389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQTLPYHLSLLNVLFPGPCSRHFKFRRGKCAQPAWRKVSAPSQDLLITKVMWAMESGHL
LWALLFMQSLWPQLTDGATRVYYLGIRDVQWNYAPKGRNVITNQPLDSDIVASSFLKSDK
NRIGGTYKKTIYKEYKDDSYTDEVAQPAWLGFLGPVLQAEVGDVILIHLKNFATRPYTIH
PHGVFYEKDSEGSLYPDGSSGPLKADDSVPPGGSHIYNWTIPEGHAPTDADPACLTWIYH
SHVDAPRDIATGLIGPLITCKRGALDGNSPPQRQDVDHDFFLLFSVVDENLSWHLNENIA
TYCSDPASVDKEDETFQESNRMHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHTA
FFHGQMLTTRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQALYKVKSC
SMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSISDKFFQKSSSRIGG
TYWKVRYEAFQDETFQEKMHLEEDRHLGILGPVIRAEVGDTIQVVFYNRASQPFSMQPHG
VFYEKDYEGTVYNDGSSYPGLVAKPFEKVTYRWTVPPHAGPTAQDPACLTWMYFSAADPI
RDTNSGLVGPLLVCRAGALGADGKQKGVDKEFFLLFTVLDENKSWYSNANQAAAMLDFRL
LSEDIEGFQDSNRMHAINGFLFSNLPRLDMCKGDTVAWHLLGLGTETDVHGVMFQGNTVQ
LQGMRKGAAMLFPHTFVMAIMQPDNLGTFEIYCQAGSHREAGMRAIYNVSQCPGHQATPR
QRYQAARIYYIMAEEVEWDYCPDRSWEREWHNQSEKDSYGYIFLSNKDGLLGSRYKKAVF
REYTDGTFRIPRPRTGPEEHLGILGPLIKGEVGDILTVVFKNNASRPYSVHAHGVLESTT
VWPLAAEPGEVVTYQWNIPERSGPGPNDSACVSWIYYSAVDPIKDMYSGLVGPLAICQKG
ILEPHGGRSDMDREFALLFLIFDENKSWYLEENVATHGSQDPGSINLQDETFLESNKMHA
INGKLYANLRGLTMYQGERVAWYMLAMGQDVDLHTIHFHAESFLYRNGENYRADVVDLFP
GTFEVVEMVASNPGTWLMHCHVTDHVHAGMETLFTVFSRTEHLSPLTVITKETEKAVPPR
DIEEGNVKMLGMQIPIKNVEMLASVLVAISVTLLLVVLALGGVVWYQHRQRKLRRNRRSI
LDDSFKLLSFKQ
Download sequence
Identical sequences ENSP00000430620 gi|281485618|ref|NP_620074.3| ENSP00000430620 ENSP00000430620 NP_620074.3.87134 NP_620074.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]