SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431539 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431539
Domain Number 1 Region: 245-345
Classification Level Classification E-value
Superfamily HMG-box 6.55e-24
Family HMG-box 0.00000155
Further Details:      
 
Domain Number 2 Region: 518-616
Classification Level Classification E-value
Superfamily HMG-box 2.09e-22
Family HMG-box 0.00000378
Further Details:      
 
Domain Number 3 Region: 103-185
Classification Level Classification E-value
Superfamily HMG-box 2.49e-21
Family HMG-box 0.00000347
Further Details:      
 
Domain Number 4 Region: 355-432
Classification Level Classification E-value
Superfamily HMG-box 6.94e-17
Family HMG-box 0.00000966
Further Details:      
 
Domain Number 5 Region: 443-522
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000144
Family HMG-box 0.00000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431539   Gene: ENSG00000108312   Transcript: ENST00000527034
Sequence length 745
Comment pep:novel chromosome:GRCh37:17:42283962:42298222:-1 gene:ENSG00000108312 transcript:ENST00000527034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAF
KDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYF
RFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFR
EDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDEIMRDYIQKHPELNISEEGI
TKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQ
KEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQ
EGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYK
AREAALKAQSERKPGGEREERGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEM
TWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQK
FSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSL
SPQDRAAYKEYISNKRKSMTKLRGPNPKSSRTTLQSKSPRRMMKRMRMTRTRMKKRKMMR
MGTPLKMAATPLSPAARTRARMGMRMKRMTRTKTTTRMTMRMKIMSPRAAAPAPPPQGTP
QTLTPTEAQPHPRAARESPGAPLPN
Download sequence
Identical sequences A0A2J8J4G4 E9PKP7
ENSP00000431539 ENSP00000431539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]