SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431723 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431723
Domain Number 1 Region: 214-301,507-544
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.44e-44
Family Inhibitor of apoptosis (IAP) repeat 0.00000198
Further Details:      
 
Domain Number 2 Region: 127-202
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.14e-31
Family Inhibitor of apoptosis (IAP) repeat 0.0000787
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.88e-27
Family Inhibitor of apoptosis (IAP) repeat 0.0004
Further Details:      
 
Domain Number 4 Region: 404-502
Classification Level Classification E-value
Superfamily DEATH domain 6.12e-23
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431723   Gene: ENSG00000110330   Transcript: ENST00000530675
Sequence length 569
Comment pep:putative chromosome:GRCh37:11:102217945:102248967:1 gene:ENSG00000110330 transcript:ENST00000530675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPS
CSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDI
SSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSN
WEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQ
LASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQ
GRYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLV
KQTVQSKILTTGENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALF
QQLTCVLPILDNLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLK
EIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHL
VVCQECAPSLRKCPICRGIIKGTVRTFLS
Download sequence
Identical sequences ENSP00000431723 ENSP00000431723 NP_001243095.1.87134 NP_001243095.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]