SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434516 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434516
Domain Number 1 Region: 160-540
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.77e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000857
Further Details:      
 
Domain Number 2 Region: 517-648
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.41e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000158
Further Details:      
 
Domain Number 3 Region: 59-150
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.13e-16
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434516   Gene: ENSG00000198431   Transcript: ENST00000525566
Sequence length 649
Comment pep:known chromosome:GRCh37:12:104609557:104744061:1 gene:ENSG00000198431 transcript:ENST00000525566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCAEGKAVAAAAPTELQTKGKNGDGRRRSAKDHHPGKTLPENPAGFTSTATADSRALLQ
AYIDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDL
PVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKE
AAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
EETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEK
IYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLA
GIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVV
AQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIY
AIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKA
VEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQ
GFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG
Download sequence
Identical sequences Q16881
ENSP00000412045 ENSP00000434516 NP_001087240.1.87134 NP_001087240.1.92137 gi|148277071|ref|NP_001087240.1| ENSP00000434516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]