SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434979 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434979
Domain Number 1 Region: 242-329,535-572
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.7e-44
Family Inhibitor of apoptosis (IAP) repeat 0.00000198
Further Details:      
 
Domain Number 2 Region: 155-230
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.23e-31
Family Inhibitor of apoptosis (IAP) repeat 0.0000787
Further Details:      
 
Domain Number 3 Region: 18-116
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.88e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00033
Further Details:      
 
Domain Number 4 Region: 432-530
Classification Level Classification E-value
Superfamily DEATH domain 6.59e-23
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434979   Gene: ENSG00000110330   Transcript: ENST00000532672
Sequence length 597
Comment pep:putative chromosome:GRCh37:11:102217978:102249400:1 gene:ENSG00000110330 transcript:ENST00000532672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKV
KCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSP
TLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSP
SELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSI
SNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDD
PWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGEENADPPIIHFGPG
ESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEK
REEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQ
IPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQ
LRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS
Download sequence
Identical sequences E9PMH5
ENSP00000434979 ENSP00000434979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]