SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000436656 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436656
Domain Number 1 Region: 222-475
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.06e-55
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 36-151
Classification Level Classification E-value
Superfamily POZ domain 1.81e-29
Family Tetramerization domain of potassium channels 0.0000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436656   Gene: ENSG00000116396   Transcript: ENST00000469655
Sequence length 635
Comment pep:known chromosome:GRCh37:1:110753965:110776666:1 gene:ENSG00000116396 transcript:ENST00000469655 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGT
RLAWLADPDGGGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPAD
VCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDD
ERELALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSI
TTFCLETHEAFNIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRI
VCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKL
TRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDF
KNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYS
LAMAKQKLPKKRKKHVPRPAQLESPMYCKSEETSPRDSTCSDTSPPAREEGMIERKRADS
KQNGDANAVLSDEEGAGLTQPLASSPTPEERRALRRSTTRDRNKKAAACFLLSTGDYACA
DGSVRKGTFVLRDLPLQHSPEAACPPTAGTLFLPH
Download sequence
Identical sequences Q03721
NP_004969.2.87134 NP_004969.2.92137 ENSP00000358802 ENSP00000436656 ENSP00000358802 gi|24497462|ref|NP_004969.2| ENSP00000358802 ENSP00000436656 9606.ENSP00000358802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]