SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437909 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437909
Domain Number 1 Region: 1-68
Classification Level Classification E-value
Superfamily E set domains 0.00000000000382
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.048
Further Details:      
 
Weak hits

Sequence:  ENSP00000437909
Domain Number - Region: 74-122
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0188
Family HLH, helix-loop-helix DNA-binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437909   Gene: ENSG00000221818   Transcript: ENST00000535548
Sequence length 264
Comment pep:known chromosome:GRCh37:8:25702125:25745432:-1 gene:ENSG00000221818 transcript:ENST00000535548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGA
PGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLAKEMLLKRAADLVEALYGTPHNNQD
IILKRAADIAEALYSVPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGY
IRNTSSISPRGYSSSSTPQQSNYSTSSNSMNGYSNVPMANLGVPGSPGFLNGSPTGSPYG
TGLWLTWLLKAFWGKKRIETIPFL
Download sequence
Identical sequences A0A2I2YHD3 A0A2I3N4T2 A0A2J8X4X9 A0A2K5N4L9 A0A2K5W311 A0A2K5Z303 A0A2K6DG56 F6W1L5 H2Q2S3
ENSP00000437909 ENSP00000437909 ENSMMUP00000007605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]