SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000438136 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000438136
Domain Number 1 Region: 35-144
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.67e-23
Family L-aminoacid/polyamine oxidase 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSP00000438136
Domain Number - Region: 2-52
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00155
Family FAD/NAD-linked reductases, N-terminal and central domains 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000438136   Gene: ENSG00000143224   Transcript: ENST00000537829
Sequence length 161
Comment pep:putative chromosome:GRCh37:1:161139475:161141008:1 gene:ENSG00000143224 transcript:ENST00000537829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XADHVISAIPASVLSELLPAEAAPLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPS
SEDPGVLGIVYDSVAFPEQDGSPPGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAA
ATQLGLKEMPSHCLVHLHKNCIPQYTLGHWQKLGKLGKQLG
Download sequence
Identical sequences H0YFE1
ENSP00000438136 ENSP00000438136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]