SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000438741 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000438741
Domain Number 1 Region: 63-128
Classification Level Classification E-value
Superfamily XPC-binding domain 4.32e-22
Family XPC-binding domain 0.0000365
Further Details:      
 
Domain Number 2 Region: 137-196
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000413
Family UBA domain 0.00035
Further Details:      
 
Domain Number 3 Region: 2-38
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000997
Family UBA domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000438741   Gene: ENSG00000179262   Transcript: ENST00000541222
Sequence length 198
Comment pep:known chromosome:GRCh37:19:13056669:13064083:1 gene:ENSG00000179262 transcript:ENST00000541222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATE
AAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLN
EPPGELADISDVEGEVGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACE
KNENLAANFLLSQNFDDE
Download sequence
Identical sequences B4DDJ7
ENSP00000438741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]