SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000443492 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000443492
Domain Number 1 Region: 7-182
Classification Level Classification E-value
Superfamily RNI-like 1.29e-31
Family Cyclin A/CDK2-associated p19, Skp2 0.0000000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000443492   Gene: ENSG00000145604   Transcript: ENST00000546211
Sequence length 210
Comment pep:known chromosome:GRCh37:5:36152230:36182616:1 gene:ENSG00000145604 transcript:ENST00000546211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPLAEHFSTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHV
QVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQL
NYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFT
TIARPTIGNKKNQEIWGIKCRLTLQKPSCL
Download sequence
Identical sequences A0A2I2YCP8 A0A2I3TNI2
ENSP00000443492 NP_001230049.1.87134 NP_001230049.1.92137 ENSP00000478031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]