SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444097 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444097
Domain Number 1 Region: 173-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 35-173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000107
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444097   Gene: ENSG00000187942   Transcript: ENST00000543870
Sequence length 272
Comment pep:known chromosome:GRCh37:1:22138856:22150456:1 gene:ENSG00000187942 transcript:ENST00000543870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEACCLLQLPQRLLLLGAAALTATALETADLAELCGQTWQGDGLLLRSHAASRRFYFVAP
DTDCGLWVQAAAPGDRIRFQFRFFLVYSLTPAPPALNTSSPAPADPCAPGSYLQFYEGPP
GAPRPLGSPLCGLNIPVPVASSGPFLGLRLVTRGRQPRVDFVGEVTSFRLGPCGAYFRCQ
NGRCIPSSLVCDPWGMDNCGDGSDQGSWSPADCRGPSPVPSQTGSTDAHTSRSLTPSPAL
GSAGSLWIAAERSSPAGRDPTRQDAALEGSTE
Download sequence
Identical sequences Q5SZI1
ENSP00000340988 NP_001013715.2.87134 NP_001013715.2.92137 gi|224591414|ref|NP_001013715.2| ENSP00000340988 ENSP00000444097 9606.ENSP00000340988 ENSP00000340988 ENSP00000444097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]