SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445079 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445079
Domain Number 1 Region: 383-564
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-64
Family SPRY domain 0.0000024
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 3.41e-24
Family Pyrin domain, PYD 0.0031
Further Details:      
 
Domain Number 3 Region: 155-220
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.49e-16
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445079   Gene: ENSG00000103313   Transcript: ENST00000536379
Sequence length 570
Comment pep:putative chromosome:GRCh37:16:3293141:3306587:-1 gene:ENSG00000103313 transcript:ENST00000536379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTY
YGEEYAVQLTLQVLRAINQRLLAEELHRAAIQGRPPDTAASPRCHAQEGDPVDGTCVRDS
CSFPEAVSGHPQASGSRSPGCPRCQDSHERKSPGSLSPQPLPQCKRHLKQVQLLFCEDHD
EPICLICSLSQEHQGHRVRPIEEVALEHKKKIQKQLEHLKKLRKSGEEQRSYGEEKAVSF
LKQTEALKQRVQRKLEQVYYFLEQQEHFFVASLEDVGQMVGQIRKAYDTRVSQDIALLDA
LIGELEAKECQSEWELLQDIGDILHRAKTVPVPEKWTTPQEIKQKIQLLHQKSEFVEKST
KYFSETLRSEMEMFNVPELIGAQAHAVNVILDAETAYPNLIFSDDLKSVRLGNKWERLPD
GPQRFDSCIIVLGSPSFLSGRRYWEVEVGDKTAWILGACKTSISRKGNMTLSPENGYWVV
IMMKENEYQASSVPPTRLLIKEPPKRVGIFVDYRVGSISFYNVTARSHIYTFASCSFSGP
LQPIFSPGTRDGGKNTAPLTICPVGGQGPD
Download sequence
Identical sequences ENSP00000445079 ENSP00000445079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]