SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445595 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445595
Domain Number 1 Region: 213-465
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.01e-50
Family Voltage-gated potassium channels 0.0016
Further Details:      
 
Domain Number 2 Region: 50-159
Classification Level Classification E-value
Superfamily POZ domain 1.62e-25
Family Tetramerization domain of potassium channels 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445595   Gene: ENSG00000124134   Transcript: ENST00000537075
Sequence length 526
Comment pep:known chromosome:GRCh37:20:43723155:43729750:-1 gene:ENSG00000124134 transcript:ENST00000537075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDTGIRWRRSDEALRVNVGGVR
RQLSARALARFPGTRLGRLQAAASEEQARRLCDDYDEAAREFYFDRHPGFFLSLLHFYRT
GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPC
PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH
SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF
FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGKEFGHLGKVVQVFRLMRIFRVLKLARHST
GLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTVSMT
TVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHQ
EFEDLLSSIDGVSEASLETSRETSQEGQSADLESQAPSEPPHPQMY
Download sequence
Identical sequences A2RUL8 Q96KK3
ENSP00000307694 NP_001309728.1.87134 NP_001309728.1.92137 NP_002242.2.87134 NP_002242.2.92137 ENSP00000307694 ENSP00000445595 gi|13492973|ref|NP_002242.2| 9606.ENSP00000307694 ENSP00000307694 ENSP00000445595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]