SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000446166 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000446166
Domain Number 1 Region: 198-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 142-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 92-143
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-19
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 30-85
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-16
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446166   Gene: ENSG00000197054   Transcript: ENST00000545530
Sequence length 272
Comment pep:known chromosome:GRCh37:19:12075869:12090295:1 gene:ENSG00000197054 transcript:ENST00000545530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIRGDIGHKAYEYQDYAPKPYKCQQPKKAFRYHPSFRTQERNHTGEKPYACKECGKTFI
SHSGIRRRMVMHSGDGPYKCKFCGKAVHCLRLYLIHERTHTGEKPYECKQCVKSFSYSAT
HRIHERTHTGEKPYECQQCGKAFHSSSSFQAHKRTHTGGKPYECKQCGKSFSWCHSFQIH
ERTHTGEKPCECSKCNKAFRSYRSYLRHKRSHTGEKPYQCKECRKAFTYPSSLRRHERTH
SAKKPYECKQCGKALSYKFSNTPKNALWRKTL
Download sequence
Identical sequences ENSP00000446166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]