SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000449622 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000449622
Domain Number 1 Region: 118-164
Classification Level Classification E-value
Superfamily Phosphofructokinase 0.0000000000000183
Family Phosphofructokinase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449622   Gene: ENSG00000152556   Transcript: ENST00000549366
Sequence length 165
Comment pep:putative chromosome:GRCh37:12:48499899:48525125:1 gene:ENSG00000152556 transcript:ENST00000549366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKDEFHLKFFMCVIQSRQLVRTPQRTAGEASTSSMLIPKPPPKTDILKSLDTMDDPDTV
GSIPVFKTECAEVEIQVSKRKRAVVKARGDPTVETMKQREEWIMTHEEHHAAKTLGIGKA
IAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGG
Download sequence
Identical sequences F8VVE3
ENSP00000449622 ENSP00000449622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]