SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455597 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000455597
Domain Number - Region: 87-136
Classification Level Classification E-value
Superfamily Cupredoxins 0.0365
Family Multidomain cupredoxins 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455597   Gene: ENSG00000255339   Transcript: ENST00000529568
Sequence length 159
Comment pep:known chromosome:GRCh37:10:102265385:102289628:-1 gene:ENSG00000255339 transcript:ENST00000529568 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVE
DYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTS
PTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVDRP
Download sequence
Identical sequences E9PQ68
ENSP00000455597 ENSP00000455597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]