SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455790 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455790
Domain Number 1 Region: 185-528
Classification Level Classification E-value
Superfamily RNI-like 1.1e-25
Family Rna1p (RanGAP1), N-terminal domain 0.074
Further Details:      
 
Domain Number 2 Region: 105-163
Classification Level Classification E-value
Superfamily F-box domain 0.00000000222
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455790   Gene: ENSG00000261539   Transcript: ENST00000565084
Sequence length 539
Comment pep:known chromosome:GRCh37:HG243_PATCH:145410334:145413415:-1 gene:ENSG00000261539 transcript:ENST00000565084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQ
RRASRRTPRQPPRGPSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEIL
VQIFGLLVAADGPMPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKK
LLASLEWLMPNRFSQLQRLTLIHWKSQVHPVLKLVGECCPRLTFLKLSGCHGVTADALVM
LAKACCQLHSLDLQHSMVESTAVVSFLEEAGSRMRKLWLTYSSQTTAILGALLGSCCPQL
QVLEVSTGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVAPGPGFPSLEE
LCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGT
SDRLTLAKEGSPFLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSLNL
RGTRVTPSTVSSVISGCPGLLYLNLESCRCLPRGLKRAYRGLEEVQWCLEQLLTSPSPS
Download sequence
Identical sequences ENSP00000454877 ENSP00000455790 NP_036294.2.87134 NP_036294.2.92137 ENSP00000330098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]