SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457733 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457733
Domain Number 1 Region: 192-467
Classification Level Classification E-value
Superfamily Mitochondrial carrier 8.63e-83
Family Mitochondrial carrier 0.0000296
Further Details:      
 
Domain Number 2 Region: 10-186
Classification Level Classification E-value
Superfamily EF-hand 3.34e-40
Family Calmodulin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457733   Gene: ENSG00000085491   Transcript: ENST00000565488
Sequence length 477
Comment pep:known chromosome:GRCh37:1:108676658:108742980:-1 gene:ENSG00000085491 transcript:ENST00000565488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAE
EKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGL
TISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTI
PDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQ
MVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGA
TAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGI
DLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLE
GSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK
Download sequence
Identical sequences Q6NUK1
NP_037518.3.87134 NP_037518.3.92137 gi|148491091|ref|NP_037518.3| HR6585 ENSP00000264128 9606.ENSP00000264128 ENSP00000457733 ENSP00000457733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]