SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000459718 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459718
Domain Number 1 Region: 571-990
Classification Level Classification E-value
Superfamily RNI-like 2.97e-69
Family 28-residue LRR 0.0000327
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily DEATH domain 1.77e-22
Family Pyrin domain, PYD 0.0049
Further Details:      
 
Domain Number 3 Region: 171-258,287-344
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000931
Family Nucleotide and nucleoside kinases 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459718   Gene: ENSG00000263068   Transcript: ENST00000576855
Sequence length 1009
Comment pep:known chromosome:GRCh37:HSCHR19LRC_LRC_T_CTG1:55370761:55389001:-1 gene:ENSG00000263068 transcript:ENST00000576855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPQLEWTLQTLLEQLNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVN
TSSENWIRNATVNILEEMNLTELCKMAKAEMMEDGQVQEIDNPELGDAEEDSELAKPGEK
EGWRNSMEKQSLVWKNTFWQGDIDNFHDDVTLRNQRFIPFLNPRTPRKLTPYTVVLHGPA
GVGKTTLAKKCMLDWTDCNLSPTLRYAFYLSCKELSRMGPCSFAELISKDWPELQDDIPS
ILAQAQRILFVVDGLDELKVPPGALIQDICGDWEKKKPVPVLLGSLLKRKMLPRAALLVT
TRPRALRDLQLLAQQPIYVRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLG
SAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAA
QGLWAQMSVFHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFY
ALEKEEGEDRDGHAWDIGDVQKLLSGEERLKNPDLIQVGHFLFGLANEKRAKELEATFGC
RMSPDIKQELLQCKAHLHANKPLSVTDLKEVLGCLYESQEEELAKVVVAPFKEISIHLTN
TSEVMHCSFSLKHCQDLQKLSLQVAKGVFLENYMDFELDIEFESSNSNLKFLEVKQSFLS
DSSVRILCDHVTRSTCHLQKVEIKNVTPDTAYRDFCLAFIGKKTLTHLTLAGHIEWERTM
MLMLCDLLRNHKCNLQYLRLGGHCATPEQWAEFFYVLKANQSLKHLRLSANVLLDEGAML
LYKTMTRPKHFLQMLSLENCRLTEASCKDLAAVLVVSKKLTHLCLAKNPIGDTGVKFLCE
GLSYPDCKLQTLVLQQCSITKLGCRYLSEALQEACSLTNLDLSINQIARGLWILCQALEN
PNCNLKHLRLWSCSLMPFYCQHLGSALLSNQKLETLDLGQNHLWKSGIIKLFGVLRQRTG
SLKILRLKTYETNLEIKKLLEEVKEKNPKLTIDCNASGATAPPCCDFFC
Download sequence
Identical sequences ENSP00000329568 ENSP00000409137 ENSP00000458231 ENSP00000458674 ENSP00000458887 ENSP00000458962 ENSP00000459086 ENSP00000459241 ENSP00000459698 ENSP00000459718 ENSP00000459861 ENSP00000460017 ENSP00000461064 ENSP00000461257 ENSP00000461321 ENSP00000461614 ENSP00000473807 ENSP00000475132 NP_631915.2.87134 NP_631915.2.92137 ENSP00000329568 ENSP00000478890 gi|46049100|ref|NP_631915.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]