SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000460624 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000460624
Domain Number 1 Region: 31-350
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.26e-124
Family Bee venom hyaluronidase 0.0000149
Further Details:      
 
Weak hits

Sequence:  ENSP00000460624
Domain Number - Region: 413-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0964
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000460624   Gene: ENSG00000262208   Transcript: ENST00000575445
Sequence length 435
Comment pep:known chromosome:GRCh37:HG325_PATCH:50337322:50341004:-1 gene:ENSG00000262208 transcript:ENST00000575445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHLLPICALFLTLLDMAQGFRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVA
NPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAP
DFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAAR
AWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSR
ALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPL
DELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQ
ALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRC
YPGWQAPWCERKSMW
Download sequence
Identical sequences A0A024R2X3 Q12794
9606.ENSP00000266031 ENSP00000266031 ENSP00000346068 ENSP00000378576 ENSP00000477903 ENSP00000266031 ENSP00000346068 ENSP00000378576 ENSP00000459254 ENSP00000460624 ENSP00000461261 NP_149349.2.87134 NP_149349.2.92137 NP_695013.1.87134 NP_695013.1.92137 XP_011531969.1.92137 XP_011531970.1.92137 XP_011531971.1.92137 gi|24497562|ref|NP_149349.2| gi|24497564|ref|NP_695013.1| gi|6224976|ref|NP_009296.1| ENSP00000266031 ENSP00000458609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]