SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466370 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466370
Domain Number 1 Region: 69-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 17-70
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.98e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSP00000466370
Domain Number - Region: 146-289
Classification Level Classification E-value
Superfamily RNI-like 0.00785
Family 28-residue LRR 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466370   Gene: ENSG00000196381   Transcript: ENST00000590008
Sequence length 327
Comment pep:known chromosome:GRCh37:19:38159755:38183201:-1 gene:ENSG00000196381 transcript:ENST00000590008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRNAMYLKNVAETACNFQLTQYQISHANQKPYECQICGKPFRKRAHLTQHNRIHTGGKP
YECKECGKVFICCSTLIQHKRTHTSEKPYECLECRKTFRRSAHLIRHQRIHTGEKPYKCK
QCWKAFASVSDLIDIGKFTLMRDFTNVQNVGRHLTIAQLLFSIREFTLVRSPLNVRNVAK
HSIIAQHLLNTRELILMRNLMNVRNVKRLLGKVHILLNIKEFILVRNHMSVSNVGRLSLV
FLILIDIREFTLVKNPMNVKNVVELLTIVQLLFNTREFTLVRRLMNISSVGRFLSPVQHL
FNIREHILMKNLMNVSNARRPSSIMHI
Download sequence
Identical sequences A0A024R0G3
ENSP00000351391 ENSP00000466370 ENSP00000351391 ENSP00000466370 gi|46094068|ref|NP_689818.2| ENSP00000351391 NP_689818.2.87134 NP_689818.2.92137 9606.ENSP00000351391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]