SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468006 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468006
Domain Number 1 Region: 35-117
Classification Level Classification E-value
Superfamily RNI-like 1.33e-18
Family 28-residue LRR 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468006   Gene: ENSG00000163157   Transcript: ENST00000466891
Sequence length 123
Comment pep:putative chromosome:GRCh37:1:151142462:151144791:-1 gene:ENSG00000163157 transcript:ENST00000466891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDALCSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNLNNIQ
AVADMLRENRSLQSLNIESNFISSTGLMAVLKAVRENATLTELRVDNQVASKRRDNTAFP
FTN
Download sequence
Identical sequences K7EQW4
ENSP00000468006 ENSP00000468006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]