SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468292 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468292
Domain Number 1 Region: 5-156
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000196
Family SMI1/KNR4-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468292   Gene: ENSG00000134779   Transcript: ENST00000591906
Sequence length 188
Comment pep:putative chromosome:GRCh37:18:34366536:34398890:-1 gene:ENSG00000134779 transcript:ENST00000591906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAERHMISSWEQKNNCVMPEDVKNFYLMTNGFHMTWSVKLDEHIIPLGSMAINSISKLTQ
LTQSSMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSG
KPALAEDTEIWFLDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKAWGL
ATSKESAA
Download sequence
Identical sequences K7ERK3
ENSP00000468292 ENSP00000468292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]