SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000469277 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469277
Domain Number 1 Region: 67-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000275
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSP00000469277
Domain Number - Region: 374-669
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00357
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469277   Gene: ENSG00000127507   Transcript: ENST00000595839
Sequence length 681
Comment pep:putative chromosome:GRCh37:19:14847048:14887568:-1 gene:ENSG00000127507 transcript:ENST00000595839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGRVFLVFLAFCVWLTLPGAETQDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITT
PMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDM
TFSTWTPPPGVHSQTLSRFFDKVQDLGRDYKPGLANNTIQSILQALDELLEAPGDLETLP
RLQQHCVASHLLDGLEDVLRGLSKNLSNGLLNFSYPAGTELSLEVQKQVDRSVTLRQNQA
VMQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLVLEPEKQMLLHETHQGLLQDGSP
ILLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKVLCVFWEHGQNGCGHWATTGCST
IGTRDTSTICRCTHLSSFAVLMAHYDVQEEDPVLTVITYMGLSVSLLCLLLAALTFLLCK
AIQNTSTSLHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEAL
YLFLTARNLTVVNYSSINRFMKKLMFPVGYGVPAVTVAISAASRPHLYGTPSRCWLQPEK
GFIWGFLGPVCAIFSVNLVLFLVTLWILKNRLSSLNSEVSTLRNTRMLAFKATAQLFILG
CTWCLGILQVGPAARVMAYLFTIINSLQGVFIFLVYCLLSQQVREQYGKWSKGIRKLKTE
SEMHTLSSSAKADTSKPSTVN
Download sequence
Identical sequences gi|23397687|ref|NP_690882.1| ENSP00000469277 ENSP00000319838 ENSP00000469277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]