SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471278 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471278
Domain Number 1 Region: 42-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.66e-34
Family SCAN domain 0.000079
Further Details:      
 
Domain Number 2 Region: 402-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 443-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-20
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 4 Region: 360-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 233-278
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-17
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471278   Gene: ENSG00000269162   Transcript: ENST00000593516
Sequence length 510
Comment pep:known chromosome:GRCh37:HG1443_HG1444_PATCH:134419818:134478116:-1 gene:ENSG00000269162 transcript:ENST00000593516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMRELNADSCSSPQMGAMWETSGSVKENSSQSKKYSTKIENLGPESACRHFWSFRYHEA
TGPLETISQLQKLCHQWLRPEIHSKEQILEMLVLEQFLSILPKETQNWVQKHHPQNVKQA
LVLVEFLQREPDGTKNEVTAHELGKEAVLLGGTAVAPGFKWKPAEPQPMGVFQKEYWNTY
RVLQEQLGWNTHKETQPVYERAVHDQQMLALSEQKRIKHWKMASKLILPESLSLLTFEDV
AVYFSEEEWQLLNPLEKTLYNDVMQDIYETVISLGLKLKNDTGNDHPISVSTSEIQTSGC
EVSKKTRMKIAQKTMGRENPGDTHSVQKWHRAFPRKKRKKPATCKQELPKLMDLHGKGPT
GEKPFKCQECGKSFRVSSDLIKHHRIHTGEKPYKCQQCDRRFRWSSDLNKHFMTHQGIKP
YRCSWCGKSFSHNTNLHTHQRIHTGEKPFKCDECGKRFIQNSHLIKHQRTHTGEQPYTCS
LCKRNFSRRSSLLRHQKLHRRREACLVSPN
Download sequence
Identical sequences P51815
ENSP00000359802 ENSP00000471278 9606.ENSP00000359802 NP_009062.2.87134 NP_009062.2.92137 XP_005262526.1.92137 XP_011529693.1.92137 ENSP00000359802 ENSP00000359800 gi|41152070|ref|NP_009062.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]