SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000471588 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471588
Domain Number 1 Region: 133-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.12e-27
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 175-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 91-143
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 61-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000423
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471588   Gene: ENSG00000105750   Transcript: ENST00000599064
Sequence length 234
Comment pep:putative chromosome:GRCh37:19:21119398:21132255:1 gene:ENSG00000105750 transcript:ENST00000599064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSHFAQDLWPEQNIKDSFQKVTLKRYGKCRHENLPLRKGCESMDECKMHKGGCNGLNQC
LTATQSKIFQCDKYVKVAHKFSNSNRHEIRHTKKKPFKCTKCGKSFGMISCLTEHSRIHT
RVNFYKCEECGKAFNWSSTLTKHKRIHTGEKPYKCEECGKAFNQSSNLIKHKKIHTGEKP
YKCEECGKTFNRFSTLTTHKIIHTGEKPYKCKECGKAFNRSSTLTTHRKIHTGE
Download sequence
Identical sequences M0R120
ENSP00000471588 ENSP00000471588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]