SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000472474 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000472474
Domain Number 1 Region: 81-389,484-528
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.29e-63
Family FAD-linked reductases, N-terminal domain 0.00022
Further Details:      
 
Domain Number 2 Region: 370-476
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.54e-28
Family L-aminoacid/polyamine oxidase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000472474   Gene: ENSG00000104951   Transcript: ENST00000595948
Sequence length 589
Comment pep:known chromosome:GRCh37:19:50392911:50432796:-1 gene:ENSG00000104951 transcript:ENST00000595948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNDDFCPGLTIKAMGAERAPQRQPCTLHLLVLVPILLSLVASQDWKAERSQDPFEKCMQ
DPDYEQLLKVVTWGLNRTLKPQRVIVVGAGVAGLVAAKVLSDAGHKVTILEADNRIGGRI
FTYRDQNTGWIGELGAMRMPSSHRILHKLCQGLGLNLTKFTQYDKNTWTEVHEVKLRNYV
VEKVPEKLGYALRPQEKGHSPEDIYQMALNQALKDLKALGCRKAMKKFERHTLLEYLLGE
GNLSRPAVQLLGDVMSEDGFFYLSFAEALRAHSCLSDRLQYSRIVGGWDLLPRALLSSLS
GLVLLNAPVVAMTQGPHDVHVQIETSPPARNLKVLKADVVLLTASGPAVKRITFSPPLPR
HMQEALRRLHYVPATKVFLSFRRPFWREEHIEGGHSNTDRPSRMIFYPPPREGALLLASY
TWSDAAAAFAGLSREEALRLALDDVAALHGPVVRQLWDGTGVVKRWAEDQHSQGGFVVQP
PALWQTEKDDWTVPYGRIYFAGEHTAYPHGWVETAVKSALRAAIKINSRKGPASDTASPE
GHASDMEGQGHVHGVASSPSHDLAKEEGSHPPVQGQLSLQNTTHTRTSH
Download sequence
Identical sequences NP_001244946.1.87134 NP_001244946.1.92137 NP_001244947.1.87134 NP_001244947.1.92137 NP_758962.1.87134 NP_758962.1.92137 ENSP00000342557 ENSP00000472474 gi|27477089|ref|NP_758962.1| ENSP00000342557 ENSP00000472474 9606.ENSP00000342557 ENSP00000342557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]