SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000473041 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000473041
Domain Number 1 Region: 19-273
Classification Level Classification E-value
Superfamily DNase I-like 3.01e-32
Family DNase I-like 0.00000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473041   Gene: ENSG00000267993   Transcript: ENST00000595836
Sequence length 302
Comment pep:known chromosome:GRCh37:HG1497_PATCH:153570226:153577746:-1 gene:ENSG00000267993 transcript:ENST00000595836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHYPTALLFLILANGAQAFRICAFNAQRLTLAKVAREQVMDTLVRILARCDIMVLQEVVD
SSGSAIPLLLRELNRFDGSGPYSTLSSPQLGRSTYMETYVYFYRSHKTQVLSSYVYNDED
DVFAREPFVAQFSLPSNVLPSLVLVPLHTTPKAVEKELNALYDVFLEVSQHWQSKDVILL
GDFNADCASLTKKRLDKLELRTEPGFHWVIADGEDTTVRASTHCTYDRVVLHGERCRSLL
HTAAAFDFPTSFQLTEEEALNISDHYPVEVELKLSQAHSVQPLSLTVLLLLSLLSPQLCP
AA
Download sequence
Identical sequences P49184
ENSP00000014935 9606.ENSP00000014935 ENSP00000014935 ENSP00000309168 ENSP00000358822 ENSP00000358823 ENSP00000358824 ENSP00000377255 ENSP00000470406 ENSP00000471031 ENSP00000471171 ENSP00000471305 ENSP00000472669 ENSP00000473041 NP_001009932.1.87134 NP_001009932.1.92137 NP_001009933.1.87134 NP_001009933.1.92137 NP_001009934.1.87134 NP_001009934.1.92137 NP_001290549.1.87134 NP_001290549.1.92137 NP_006721.1.87134 NP_006721.1.92137 XP_005277886.1.92137 XP_011529424.1.92137 XP_016884821.1.92137 gi|5803007|ref|NP_006721.1| gi|58430942|ref|NP_001009932.1| gi|58430944|ref|NP_001009933.1| gi|58430946|ref|NP_001009934.1| ENSP00000014935 ENSP00000309168 ENSP00000358822 ENSP00000358823 ENSP00000358824 ENSP00000377255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]