SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000473529 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000473529
Domain Number 1 Region: 117-194
Classification Level Classification E-value
Superfamily PH domain-like 0.00000106
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSP00000473529
Domain Number - Region: 2-20
Classification Level Classification E-value
Superfamily Phenylalanine zipper 0.0615
Family Adapter protein APS, dimerisation domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473529   Gene: ENSG00000111252   Transcript: ENST00000550925
Sequence length 216
Comment pep:putative chromosome:GRCh37:12:111856144:111882652:1 gene:ENSG00000111252 transcript:ENST00000550925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQFTDLFQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGPAAPGLPKARSSEEL
APPRPPGPCSFQHFRRSLRHIFRRRSAGELPAAHTAAAPGTPGEAAETPARPGLAKKFLP
WSLAREPPPEALKEAVLRYSLADEASMDSGARWQRGRLALRRAPGPDGPDRVLELFDPPK
WPEPELSRLRFRLKQGLSCAHVPTRCNLAGASGIGH
Download sequence
Identical sequences R4GN84
ENSP00000473529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]