SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000473637 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000473637
Domain Number 1 Region: 63-163
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-19
Family Ankyrin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSP00000473637
Domain Number - Region: 399-427
Classification Level Classification E-value
Superfamily BLRF2-like 0.0824
Family BLRF2-like 0.014
Further Details:      
 
Domain Number - Region: 4-58
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0863
Family Pyk2-associated protein beta ARF-GAP domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473637   Gene: ENSG00000139436   Transcript: ENST00000550186
Sequence length 641
Comment pep:putative chromosome:GRCh37:12:110370862:110434029:-1 gene:ENSG00000139436 transcript:ENST00000550186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRLPC
RDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQILQ
AELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPDHK
NGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLATQ
NHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGSSL
SGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDLSD
GPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQATTN
VYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMRLQ
PFPAHASRLEKQNSTPESDYDNTPNDMEPDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVA
PSPTLPSTEDVIRKTEQITKNIQELLRAAQENKHDSYIPCSERIHVAVTEMAALFPKKPK
SDMVRTSLRLLTSSAYRLQSECKKTLPGDPGSPTDVQLVTQ
Download sequence
Identical sequences R4GNG3
ENSP00000473637 ENSP00000473637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]