SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000475436 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000475436
Domain Number 1 Region: 65-131
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.1e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000475436   Gene: ENSG00000272503   Transcript: ENST00000606502
Sequence length 219
Comment pep:known chromosome:GRCh37:HG953_PATCH:71004442:71017775:-1 gene:ENSG00000272503 transcript:ENST00000606502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENL
QLVLERRRVANAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDL
LEGAKDSKKQDPDEQSYSNNSSESHTSSARQLSRNITQHISCAFGLKNEEEGPWADGGSG
EPAHACRHSVMSTTEIISPTRSLDRFPEVELLSHRLPQV
Download sequence
Identical sequences Q6QHK4
gi|116517330|ref|NP_001004311.2| 9606.ENSP00000333097 NP_001004311.2.87134 NP_001004311.2.92137 ENSP00000333097 ENSP00000475436 ENSP00000333097 ENSP00000333097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]