SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000476080 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000476080
Domain Number - Region: 66-154
Classification Level Classification E-value
Superfamily RNI-like 0.000102
Family Cyclin A/CDK2-associated p19, Skp2 0.07
Further Details:      
 
Domain Number - Region: 161-193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000476080   Gene: ENSG00000138085   Transcript: ENST00000606999
Sequence length 229
Comment pep:novel chromosome:GRCh37:2:27435179:27440024:1 gene:ENSG00000138085 transcript:ENST00000606999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPHDPGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVAFYCKTTRELML
HARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQ
TLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQ
CVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
Download sequence
Identical sequences Q6UW56
ENSP00000476080 gi|282847380|ref|NP_001164266.1| NP_001164266.1.87134 NP_001164266.1.92137 ENSP00000476080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]