SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000476519 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000476519
Domain Number 1 Region: 367-461
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.96e-36
Family Small-conductance potassium channel 0.00000507
Further Details:      
 
Domain Number 2 Region: 236-409
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Weak hits

Sequence:  ENSP00000476519
Domain Number - Region: 468-525
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0262
Family Outer membrane efflux proteins (OEP) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000476519   Gene: ENSG00000105642   Transcript: ENST00000222249
Sequence length 543
Comment pep:known chromosome:GRCh37:19:18062102:18110889:1 gene:ENSG00000105642 transcript:ENST00000222249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQVVVAKSEPARPSPGSPR
GQPQDQDDDEDDEEDEAGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVV
MVTETELSWGVYTKESLYSFALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIA
MTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEADVDVLLSIPMFLRLYL
LGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT
VRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARV
RKHQRKFLQAIHQAQKLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEA
RLATLESRLDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAARSSPCRWTPVAPS
DCG
Download sequence
Identical sequences A0A2I3TDT7 Q92952
gi|25777643|ref|NP_002239.2| ENSP00000476519 NP_002239.2.87134 NP_002239.2.92137 XP_016790976.1.37143 ENSP00000476519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]