SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000007735 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000007735
Domain Number 1 Region: 294-365
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.79e-22
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 54-86
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000199
Family Intermediate filament protein, coiled coil region 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSP00000007735
Domain Number - Region: 167-282
Classification Level Classification E-value
Superfamily Prefoldin 0.0228
Family Prefoldin 0.009
Further Details:      
 
Domain Number - Region: 109-197
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000007735   Gene: ENSG00000006059   Transcript: ENST00000007735
Sequence length 404
Comment pep:known chromosome:GRCh37:17:39502344:39507064:-1 gene:ENSG00000006059 transcript:ENST00000007735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSCGLPSLSCRTSCSSRPCVPPSCHGCTLPGACNIPANVSNCNWFCEGSFNGSEKETM
QFLNDRLASYLEKVRQLERDNAELENLIRERSQQQEPLVCASYQSYFKTIEELQQKILCS
KSENARLVVQIDNAKLASDDFRTKYETELSLRQLVESDINGLRRILDELTLCRSDLEAQV
ESLKEELLCLKQNHEQEVNTLRCQLGDRLNVEVDAAPTVDLNQVLNETRSQYEALVETNR
REVEQWFATQTEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRDSLENTL
TESEARYSSQLSQVQRLITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRSLL
ESEDCKLPSNPCATTNACDKSTGPCISNPCGLRARCGPCNTFGY
Download sequence
Identical sequences O76009
NP_004129.2.87134 NP_004129.2.92137 gi|14917117|ref|NP_004129.2| ENSP00000007735 ENSP00000461221 9606.ENSP00000007735 ENSP00000007735 ENSP00000461221 ENSP00000007735 ENSP00000461221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]