SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000060969 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000060969
Domain Number 1 Region: 103-195
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000036
Family Spectrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000060969   Gene: ENSG00000052723   Transcript: ENST00000060969
Sequence length 211
Comment pep:known chromosome:GRCh37:1:115315396:115323298:-1 gene:ENSG00000052723 transcript:ENST00000060969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQVRQRYQE
DASDMKDMSKYKPHILLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLM
VAKKAVDAEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELE
NKELRELLSISSESLQARKENSMDTASQAIK
Download sequence
Identical sequences A0A2K5KK82 A0A2K5YWW9 H2PZQ8
ENSPTRP00000001959 9598.ENSPTRP00000001959 9606.ENSP00000358541 ENSP00000358541 ENSP00000358541 ENSPANP00000000822 ENSPTRP00000001959 NP_001095866.1.87134 NP_001095866.1.92137 XP_007975657.1.81039 XP_008971788.1.60992 XP_009426920.1.37143 XP_011856201.1.47321 XP_011938655.1.92194 ENSP00000060969 gi|156151379|ref|NP_001095866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]