SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000174618 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000174618
Domain Number 1 Region: 221-297
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.33e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000174618   Gene: ENSG00000070444   Transcript: ENST00000174618
Sequence length 582
Comment pep:known chromosome:GRCh37:17:2287354:2304412:-1 gene:ENSG00000070444 transcript:ENST00000174618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIETLLEAARFLEWQAQQQQRAREEQERLRLEQEREQEQKKANSLARLAHTLPVEEPRM
EAPPLPLSPPAPPPAPPPPLATPAPLTVIPIPVVTNSPQPLPPPPPLPAAAQPLPLAPRQ
PALVGAPGLSIKEPAPLPSRPQVPTPAPLLPDSKATIPPNGSPKPLQPLPTPVLTIAPHP
GVQPQLAPQQPPPPTLGTLKLAPAEEVKSSEQKKRPGGIGTREVHNKLEKNRRAHLKECF
ETLKRNIPNVDDKKTSNLSVLRTALRYIQSLKRKEKEYEHEMERLAREKIATQQRLAELK
HELSQWMDVLEIDRVLRQTGQPEDDQASTSTASEGEDNIDEDMEEDRAGLGPPKLSHRPQ
PELLKSTLPPPSTTPAPLPPHPHPHPHSVALPPAHLPVQQQQPQQKTPLPAPPPPPAAPA
QTLVPAPAHLVATAGGGSTVIAHTATTHASVIQTVNHVLQGPGGKHIAHIAPSAPSPAVQ
LAPATPPIGHITVHPATLNHVAHLGSQLPLYPQPVAVSHIAHTLSHQQVNGTAGLGPPAT
VMAKPAVGAQVVHHPQLVGQTVLNPVTMVTMPSFPVSTLKLA
Download sequence
Identical sequences Q99583
ENSP00000174618 gi|9945318|ref|NP_064706.1| ENSP00000174618 HR4651 9606.ENSP00000174618 ENSP00000174618 NP_064706.1.87134 NP_064706.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]