SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000190165 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000190165
Domain Number 1 Region: 22-71
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 7.32e-19
Family Cysteine-rich DNA binding domain, (DM domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 243-289
Classification Level Classification E-value
Superfamily UBA-like 0.0000001
Family CUE domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000190165   Gene: ENSG00000064218   Transcript: ENST00000190165
Sequence length 472
Comment pep:known chromosome:GRCh37:9:976964:991731:1 gene:ENSG00000064218 transcript:ENST00000190165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYGSPYLYMGGPVSQPPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCIL
IIERQRVMAAQVALRRQQANESLESLIPDSLRALPGPPPPGDAVAAPQPPPASQPSQPQP
PRPAAELAAAAALRWTAEPQPGALQAQLAKPDLTEERLGDGKSADNTEVFSDKDTDQRSS
PDVAKSKGCFTPESPEIVSVEEGGYAVQKNGGNPESRPDSPKCHAEQNHLLIEGPSGTVS
LPFSLKANRPPLEVLKKIFPNQKPTVLELILKGCGGDLVSAVEVLLSSRSSVTGAERTSA
EPESLALPSNGHIFEHTLSSYPISSSKWSVGSAFRVPDTLRFSADSSNVVPSPLAGPLQP
PFPQPPRYPLMLRNTLARSQSSPFLPNDVTLWNTMTLQQQYQLRSQYVSPFPSNSTSVFR
SSPVLPARATEDPRISIPDDGCPFVSKQSIYTEDDYDERSDSSDSRTLNTSS
Download sequence
Identical sequences Q9NQL9
NP_067063.1.87134 NP_067063.1.92137 ENSP00000190165 gi|11056048|ref|NP_067063.1| ENSP00000190165 9606.ENSP00000190165 ENSP00000190165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]