SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000204517 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000204517
Domain Number 1 Region: 49-121
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.03e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000204517   Gene: ENSG00000090447   Transcript: ENST00000204517
Sequence length 338
Comment pep:known chromosome:GRCh37:16:4307187:4323076:-1 gene:ENSG00000090447 transcript:ENST00000204517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRR
MQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQEL
SGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLE
AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAP
PPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKP
VRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP
Download sequence
Identical sequences Q01664
ENSP00000204517 gi|4507447|ref|NP_003214.1| ENSP00000204517 ENSP00000204517 9606.ENSP00000204517 NP_003214.1.87134 NP_003214.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]