SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000216658 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000216658
Domain Number 1 Region: 1049-1131
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-20
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 747-806
Classification Level Classification E-value
Superfamily BPTI-like 9.22e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0025
Further Details:      
 
Domain Number 3 Region: 1135-1222
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-18
Family I set domains 0.053
Further Details:      
 
Domain Number 4 Region: 915-995
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000324
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 302-360
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000222
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 366-424
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000301
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 7 Region: 27-75
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000929
Family TSP-1 type 1 repeat 0.00078
Further Details:      
 
Domain Number 8 Region: 486-538
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 9 Region: 423-480
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000353
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000216658   Gene: ENSG00000100767   Transcript: ENST00000216658
Sequence length 1278
Comment pep:known chromosome:GRCh37:14:73704288:73740073:1 gene:ENSG00000100767 transcript:ENST00000216658 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MRLLLLVPLLLAPAPGSSAPKVRRQSDTWGPWSQWSPCSRTCGGGVSFRERPCYSQRRDG
GSSCVGPARSHRSCRTESCPDGARDFRAEQCAEFDGAEFQGRRYRWLPYYSAPNKCELNC
IPKGENFYYKHREAVVDGTPCEPGKRDVCVDGSCRVVGCDHELDSSKQEDKCLRCGGDGT
TCYPVAGTFDANDLSRGYNQILIVPMGATSILIDEAAASRNFLAVKNVRGEYYLNGHWTI
EAARALPAASTILHYERGAEGDLAPERLHARGPTSEPLVIELISQEPNPGVHYEYHLPLR
RPSPGFSWSHGSWSDCSAECGGGHQSRLVFCTIDHEAYPDHMCQRQPRPADRRSCNLHPC
PETKRWKAGPWAPCSASCGGGSQSRSVYCISSDGAGIQEAVEEAECAGLPGKPPAIQACN
LQRCAAWSPEPWGECSVSCGVGVRKRSVTCRGERGSLLHTAACSLEDRPPLTEPCVHEDC
PLLSDQAWHVGTWGLCSKSCSSGTRRRQVICAIGPPSHCGSLQHSKPVDVEPCNTQPCHL
PQEVPSMQDVHTPASNPWMPLGPQESPASDSRGQWWAAQEHPSARGDHRGERGDPRGDQG
THLSALGPAPSLQQPPYQQPLRSGSGPHDCRHSPHGCCPDGHTASLGPQWQGCPGAPCQQ
SRYGCCPDRVSVAEGPHHAGCTKSYGGDSTGGMPRSRAVASTVHNTHQPQAQQNEPSECR
GSQFGCCYDNVATAAGPLGEGCVGQPSHAYPVRCLLPSAHGSCADWAARWYFVASVGQCN
RFWYGGCHGNANNFASEQECMSSCQGSLHGPRRPQPGASGRSTHTDGGGSSPAGEQEPSQ
HRTGAAVQRKPWPSGGLWRQDQQPGPGEAPHTQAFGEWPWGQELGSRAPGLGGDAGSPAP
PFHSSSYRISLAGVEPSLVQAALGQLVRLSCSDDTAPESQAAWQKDGQPISSDRHRLQFD
GSLIIHPLQAEDAGTYSCGSTRPGRDSQKIQLRIIGGDMAVLSEAELSRFPQPRDPAQDF
GQAGAAGPLGAIPSSHPQPANRLRLDQNQPRVVDASPGQRIRMTCRAEGFPPPAIEWQRD
GQPVSSPRHQLQPDGSLVISRVAVEDGGFYTCVAFNGQDRDQRWVQLRVLGELTISGLPP
TVTVPEGDTARLLCVVAGESVNIRWSRNGLPVQADGHRVHQSPDGTLLIYNLRARDEGSY
TCSAYQGSQAVSRSTEVKVVSPAPTAQPRDPGRDCVDQPELANCDLILQAQLCGNEYYSS
FCCASCSRFQPHAQPIWQ
Download sequence
Identical sequences O95428
ENSP00000451803 ENSP00000403403 ENSP00000451803 XP_011535592.1.92137 XP_011535593.1.92137 XP_011535594.1.92137 NYSGRC-IgSF-PPN_HUMAN ENSP00000216658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]