SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000217260 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000217260
Domain Number 1 Region: 37-157
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000113
Family Growth factor receptor domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSP00000217260
Domain Number - Region: 138-190
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00259
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000217260   Gene: ENSG00000101282   Transcript: ENST00000217260
Sequence length 234
Comment pep:known chromosome:GRCh37:20:939095:982904:-1 gene:ENSG00000101282 transcript:ENST00000217260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPLCLLLLVAHAVDMLALNRRKKQVGTGLGGNCTGCIICSEENGCSTCQQRLFLFIRR
EGIRQYGKCLHDCPPGYFGIRGQEVNRCKKCGATCESCFSQDFCIRCKRQFYLYKGKCLP
TCPPGTLAHQNTRECQGECELGPWGGWSPCTHNGKTCGSAWGLESRVREAGRAGHEEAAT
CQVLSESRKCPIQRPCPGERSPGQKKGRKDRRPRKDRKLDRRLDVRPRQPGLQP
Download sequence
Identical sequences Q2I0M5
NP_001025042.2.87134 NP_001025042.2.92137 9606.ENSP00000217260 ENSP00000217260 gi|83722284|ref|NP_001025042.2| ENSP00000217260 ENSP00000217260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]