SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000222254 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000222254
Domain Number 1 Region: 613-718
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-32
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 323-427
Classification Level Classification E-value
Superfamily SH2 domain 1.27e-29
Family SH2 domain 0.00000218
Further Details:      
 
Domain Number 3 Region: 113-261
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-16
Family BCR-homology GTPase activation domain (BH-domain) 0.00035
Further Details:      
 
Domain Number 4 Region: 5-82
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000374
Family SH3-domain 0.0000952
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000222254   Gene: ENSG00000105647   Transcript: ENST00000222254
Sequence length 728
Comment pep:known chromosome:GRCh37:19:18263928:18281343:1 gene:ENSG00000105647 transcript:ENST00000222254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLA
LPAPLVTPEASAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVASRAPALG
PAVRALGATFGPLLLRAPPPPSSPPPGGAPDGSEPSPDFPALLVEKLLQEHLEEQEVAPP
ALPPKPPKAKPASTVLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSK
IQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTR
LLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTA
IEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRT
KLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNE
TEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVV
VDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPG
PGPPPAAR
Download sequence
Identical sequences O00459
ENSP00000222254 ENSP00000222254 ENSP00000471914 ENSP00000222254 ENSP00000471914 ENSP00000477864 9606.ENSP00000222254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]