SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000222823 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000222823
Domain Number 1 Region: 678-943
Classification Level Classification E-value
Superfamily RNI-like 2.35e-64
Family 28-residue LRR 0.0023
Further Details:      
 
Domain Number 2 Region: 17-93
Classification Level Classification E-value
Superfamily DEATH domain 2.26e-18
Family Caspase recruitment domain, CARD 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSP00000222823
Domain Number - Region: 193-292
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00127
Family G proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000222823   Gene: ENSG00000106100   Transcript: ENST00000222823
Sequence length 953
Comment pep:known chromosome:GRCh37:7:30464143:30518396:-1 gene:ENSG00000106100 transcript:ENST00000222823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCA
CPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSPSLLTQSKVV
VNTDPVSRYTQQLRHHLGRDSKFVLCYAQKEELLLEEIYMDTIMELVGFSNESLGSLNSL
ACLLDHTTGILNEQGETIFILGDAGVGKSMLLQRLQSLWATGRLDAGVKFFFHFRCRMFS
CFKESDRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVALFTFDGLDELHSDLDLSRVPD
SSCPWEPAHPLVLLANLLSGKLLKGASKLLTARTGIEVPRQFLRKKVLLRGFSPSHLRAY
ARRMFPERALQDRLLSQLEANPNLCSLCSVPLFCWIIFRCFQHFRAAFEGSPQLPDCTMT
LTDVFLLVTEVHLNRMQPSSLVQRNTRSPVETLHAGRDTLCSLGQVAHRGMEKSLFVFTQ
EEVQASGLQERDMQLGFLRALPELGPGGDQQSYEFFHLTLQAFFTAFFLVLDDRVGTQEL
LRFFQEWMPPAGAATTSCYPPFLPFQCLQGSGPAREDLFKNKDHFQFTNLFLCGLLSKAK
QKLLRHLVPAAALRRKRKALWAHLFSSLRGYLKSLPRVQVESFNQVQAMPTFIWMLRCIY
ETQSQKVGQLAARGICANYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGV
RELQPCFSRLTVLRLSVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKIL
DECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHP
SLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKH
LWLIQNQITAKGTAQLADALQSNTGITEICLNGNLIKPEEAKVYEDEKRIICF
Download sequence
Identical sequences A0A024RA73 Q9Y239
gi|5174617|ref|NP_006083.1| HR6003 NP_006083.1.87134 NP_006083.1.92137 XP_005249625.1.92137 XP_005249629.1.92137 XP_006715696.1.92137 XP_011513381.1.92137 XP_011513382.1.92137 XP_011513383.1.92137 ENSP00000222823 ENSP00000222823 ENSP00000222823 9606.ENSP00000222823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]