SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000222990 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000222990
Domain Number 1 Region: 83-178
Classification Level Classification E-value
Superfamily PX domain 1.2e-23
Family PX domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSP00000222990
Domain Number - Region: 256-428
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0513
Family BAR domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000222990   Gene: ENSG00000106266   Transcript: ENST00000222990
Sequence length 465
Comment pep:known chromosome:GRCh37:7:2291405:2354099:-1 gene:ENSG00000106266 transcript:ENST00000222990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRAMDPLPAAAVGAAAEAEADEEADPPASDLPTPQAIEPQAIVQQVPAPSRMQMPQGN
PLLLSHTLQELLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEML
LHKFPYRMVPALPPKRMLGADREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGS
DVQNKLKESAQCVGDEFLNCKLATRAKDFLPADIQAQFAISRELIRNIYNSFHKLRDRAE
RIASRAIDNAADLLIFGKELSAIGSDTTPLPSWAALNSSTWGSLKQALKGLSVEFALLAD
KAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERHEKGVLHKHQRALHKYSLMKRQMMSAT
AQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCLHQETQLIHVYLPLTSHILRAFVN
SQIQGHKEMSKVWNDLRPKLSCLFAGPHSTLTPPCSPPEDGLCPH
Download sequence
Identical sequences Q9Y5X2
ENSP00000222990 ENSP00000222990 9606.ENSP00000222990 ENSP00000222990 gi|23943858|ref|NP_037453.1| NP_037453.1.87134 NP_037453.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]