SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000233954 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000233954
Domain Number 1 Region: 369-541
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.75e-28
Family Toll/Interleukin receptor TIR domain 0.00079
Further Details:      
 
Domain Number 2 Region: 26-105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000133
Family I set domains 0.043
Further Details:      
 
Domain Number 3 Region: 222-318
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000047
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 128-195
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000139
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000233954   Gene: ENSG00000115602   Transcript: ENST00000233954
Sequence length 556
Comment pep:known chromosome:GRCh37:2:102927962:102968497:1 gene:ENSG00000115602 transcript:ENST00000233954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQ
ERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYS
TVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT
CKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFG
KGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQ
YDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLL
WRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIY
GRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILI
EMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSK
IPRKASSLTPLAAQKQ
Download sequence
Identical sequences Q01638
9606.ENSP00000233954 ENSP00000233954 NP_057316.3.87134 NP_057316.3.92137 XP_006712902.1.92137 NYSGRC-IgSF-ILRL1_HUMAN ENSP00000233954 gi|27894324|ref|NP_057316.3| ENSP00000233954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]