SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000239151 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000239151
Domain Number 1 Region: 183-253
Classification Level Classification E-value
Superfamily Homeodomain-like 1.24e-26
Family Homeodomain 0.0000785
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000239151   Gene: ENSG00000120075   Transcript: ENST00000239151
Sequence length 269
Comment pep:known chromosome:GRCh37:17:46668619:46671323:-1 gene:ENSG00000120075 transcript:ENST00000239151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSS
ASSSHFGAVGESSRAFPAPAQEPRFRQAASSCSLSSPESLPCTNGDSHGAKPSASSPSDQ
ATSASSSANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWM
RKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKI
WFQNRRMKWKKDNKLKSMSLATAGSAFQP
Download sequence
Identical sequences A0A0D9S3S6 A0A2K5CVL4 A0A2K5JRT1 A0A2K6JWH8 A0A2K6P899 A0A2K6S9D7 H2NVH7 H2QDC1 P09067
ENSPTRP00000015904 ENSP00000239151 ENSP00000239151 NP_002138.1.87134 NP_002138.1.92137 XP_001173004.1.37143 XP_002834298.1.23681 XP_003827551.1.60992 XP_003931278.1.74449 XP_008011196.1.81039 XP_010357917.1.97406 XP_011815267.1.43180 XP_012307262.1.9421 XP_017709453.1.44346 ENSP00000239151 9598.ENSPTRP00000015904 9600.ENSPPYP00000009978 9606.ENSP00000239151 ENSPPYP00000009978 ENSPPYP00000009978 ENSPTRP00000015904 gi|4504469|ref|NP_002138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]