SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000240727 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000240727
Domain Number 1 Region: 99-189
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.39e-33
Family SCAN domain 0.0000683
Further Details:      
 
Domain Number 2 Region: 467-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000119
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSP00000240727
Domain Number - Region: 284-319
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0536
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000240727   Gene: ENSG00000121413   Transcript: ENST00000240727
Sequence length 566
Comment pep:known chromosome:GRCh37:19:58595212:58609730:-1 gene:ENSG00000121413 transcript:ENST00000240727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVGGRADEDATAAGSLWVLAPPEPTGHLVIPGTSPLEPPCPWLDSHIFQCRFGKMLPL
EKAFASPRSSPAPPDLPTPGSAAGVQQEEPETIPERTPADLEFSRLRFREFVYQEAAGPH
QTLARLHELCRQWLMPEARSKEQMLELLVLEQFLGILPDKVRPWVVAQYPESCKKAASLV
EGLADVLEEPGMLLGSPAGSSSILSDGVYERHMDPLLLPGELASPSQALGAGEIPAPSET
PWLSPDPLFLEQRRVREAKTEEDGPANTEQKLKSFPEDPQHLGEWGHLDPAEENLKSYRK
LLLWGYQLSQPDAASRLDTEELRLVERDPQGSSLPEGGRRQESAGCACEEAAPAGVLPEL
PTEAPPGDALADPPSGTTEEEEEQPGKAPDPQDPQDAESDSATGSQRQSVIQQPAPDRGT
AKLGTKRPHPEDGDGQSLEGVSSSGDSAGLEAGQGPGADEPGLSRGKPYACGECGEAFAW
LSHLMEHHSSHGGRKRYACQGCWKTFHFSLALAEHQKTHEKEKSYALGGARGPQPSTREA
QAGARAGGPPESVEGEAPPAPPEAQR
Download sequence
Identical sequences ENSP00000470123 NP_001139014.1.87134 NP_001139014.1.92137 ENSP00000240727 gi|224493905|ref|NP_001139014.1| ENSP00000470123 9606.ENSP00000412253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]