SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000242591 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000242591
Domain Number - Region: 420-463
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 0.00523
Family E2F dimerization segment 0.021
Further Details:      
 
Domain Number - Region: 36-69
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0068
Family MgtE N-terminal domain-like 0.013
Further Details:      
 
Domain Number - Region: 463-572
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00785
Family IMD domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000242591   Gene: ENSG00000122970   Transcript: ENST00000242591
Sequence length 676
Comment pep:known chromosome:GRCh37:12:110562182:110656602:1 gene:ENSG00000122970 transcript:ENST00000242591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQIKFIMDSLNKEPFRKNYNLITFDSLEPMQLLQVLSDVLAEIDPKQLVDIREEMPEQ
TAKRMLSLLGILKYKPSGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRTNELKKRAYLAR
FLIKLEVPSEFLQDETVADTNKQYEELMEAFKTLHKEYEQLKISGFSTAEIRKDISAMEE
EKDQLIKRVEHLKKRVETAQNHQWMLKIARQLRVEKEREEYLAQQKQEQKNQLFHAVQRL
QRVQNQLKSMRQAAADAKPESLMKRLEEEIKFNLYMVTEKFPKELENKKKELHFLQKVVS
EPAMGHSDLLELESKINEINTEINQLIEKKMMRNEPIEGKLSLYRQQASIISRKKEAKAE
ELQEAKEKLASLEREASVKRNQTREFDGTEVLKGDEFKRYVNKLRSKSTVFKKKHQIIAE
LKAEFGLLQRTEELLKQRHENIQQQLQTMEEKKGISGYSYTQEELERVSALKSEVDEMKG
RTLDDMSEMVKKLYSLVSEKKSALASVIKELRQLRQKYQELTQECDEKKSQYDSCAAGLE
SNRSKLEQEVRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAI
REQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQT
SIGQVIQEGGEDRLIL
Download sequence
Identical sequences A0A024RBJ1 Q8WYA0
ENSP00000242591 ENSP00000449718 NYSGRC-32526901 9606.ENSP00000242591 ENSP00000242591 gi|219555661|ref|NP_001137251.1| gi|32526901|ref|NP_054774.2| NP_001137251.1.87134 NP_001137251.1.92137 NP_054774.2.87134 NP_054774.2.92137 XP_016874706.1.92137 ENSP00000242591 ENSP00000449718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]